PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.13G050300.1.p
Common NameGLYMA_13G050300, LOC100782635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family CO-like
Protein Properties Length: 362aa    MW: 40218.8 Da    PI: 5.2685
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.13G050300.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box17.77.5e-061858438
             zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Ht 38
                         ++C+++ + +  l+C+ ++ +lC +C    H        H+
  Glyma.13G050300.1.p 18 HVCDTCRSAPCVLYCHADSAYLCSSCDARVHAAnrvasrHE 58
                         58*************************99995555666665 PP

2zf-B_box28.72.7e-0960105342
             zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                           ++C+ +e+ ++ + C+ +   lC +C   +H+       H +vp+
  Glyma.13G050300.1.p  60 VWVCEACERAPAAFLCKADAASLCSSCDADIHSAnplasrHHRVPI 105
                          689*****************************66899999877775 PP

3CCT70.25.2e-24292335144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          Rea++lRY+eK+ktRkFeKkirY+sRKa+Ae+RpR+KGrF+k++
  Glyma.13G050300.1.p 292 REARVLRYREKKKTRKFEKKIRYASRKAYAETRPRIKGRFAKRT 335
                          9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003368.7E-71562IPR000315B-box-type zinc finger
PROSITE profilePS5011910.2241562IPR000315B-box-type zinc finger
CDDcd000214.55E-81962No hitNo description
PROSITE profilePS5011910.97858105IPR000315B-box-type zinc finger
PfamPF006432.6E-759105IPR000315B-box-type zinc finger
CDDcd000214.73E-861105No hitNo description
SMARTSM003364.5E-863105IPR000315B-box-type zinc finger
PROSITE profilePS5101716.827292334IPR010402CCT domain
PfamPF062038.0E-18292334IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009416Biological Processresponse to light stimulus
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 362 aa     Download sequence    Send to blast
MLKEGTNNVG GSTGTWSHVC DTCRSAPCVL YCHADSAYLC SSCDARVHAA NRVASRHERV  60
WVCEACERAP AAFLCKADAA SLCSSCDADI HSANPLASRH HRVPILPISG SLFGEPEHER  120
VYAFVNEVEA EEEEEEVFDE YDEVEAASWL LPHPMKNDKI DENGGDKGFL FGDEYFDNLV  180
DCNSCGHNNN QFSNVYDQHQ QNYSNTVPQN YAVVPVQVPQ HFQPGLDFDS SKAGFSYDGS  240
LSQSVSVSSM DVGVVLESTI SDISMSHSKS PIGTTDLFPP LPMPSHLTPM DREARVLRYR  300
EKKKTRKFEK KIRYASRKAY AETRPRIKGR FAKRTDVEAE VDQMFSTTLF TEVGGSIFPT  360
F*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2358810.0AC235881.2 Glycine max clone GM_WBc0011H22, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003541197.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 2-like
SwissprotQ965021e-120COL2_ARATH; Zinc finger protein CONSTANS-LIKE 2
TrEMBLI1LWY20.0I1LWY2_SOYBN; Uncharacterized protein
STRINGGLYMA13G07030.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38273352
Representative plantOGRP6911767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02380.14e-76CONSTANS-like 2